PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G054500.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 842aa    MW: 96465.5 Da    PI: 10.2635
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G054500.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding391.9e-12296340348
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         W +e+d +l  av+ +G ++W ++a+++  gRt+ qc +rw k l
  Aqcoe3G054500.2.p 296 DWLEEDDAQLRSAVEAFGENNWQLVASYVE-GRTGTQCSNRWMKTL 340
                        79****************************.***********9975 PP

2Myb_DNA-binding49.68.8e-16348393248
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        grWT eEd+ l+ av ++G++tW++I++ ++ gRt  qc++rw ++l
  Aqcoe3G054500.2.p 348 GRWTIEEDKHLKVAVVLFGSKTWNKISQFVP-GRTQAQCRERWVNVL 393
                        8******************************.***********9975 PP

3Myb_DNA-binding47.34.8e-15401443347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        rWT++Ed +l+ a++++G   W+++a+ ++  Rt++qc+ rw  +
  Aqcoe3G054500.2.p 401 RWTADEDFKLKAAIAEHGHC-WRKVAEAVP-PRTDNQCRRRWKVL 443
                        8*****************99.*********.9**********865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.5140237IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-8144159IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-8208248IPR009057Homeodomain-like
PROSITE profilePS500905.215210235IPR017877Myb-like domain
SuperFamilySSF466891.64E-15220288IPR009057Homeodomain-like
PROSITE profilePS500908.699236288IPR017877Myb-like domain
SMARTSM007170.0028240290IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-10249300IPR009057Homeodomain-like
SuperFamilySSF466894.45E-18273343IPR009057Homeodomain-like
PROSITE profilePS5129420.888289344IPR017930Myb domain
SMARTSM007174.6E-13293342IPR001005SANT/Myb domain
PfamPF002492.1E-11295339IPR001005SANT/Myb domain
CDDcd001675.22E-10297340No hitNo description
Gene3DG3DSA:1.10.10.601.5E-15301343IPR009057Homeodomain-like
PROSITE profilePS5009010.371342393IPR017877Myb-like domain
SuperFamilySSF466896.47E-26346440IPR009057Homeodomain-like
SMARTSM007175.2E-11346395IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-18348398IPR009057Homeodomain-like
PfamPF002492.4E-14348393IPR001005SANT/Myb domain
CDDcd001673.44E-9349393No hitNo description
PROSITE profilePS5129422.242394448IPR017930Myb domain
SMARTSM007174.1E-13398446IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-17399442IPR009057Homeodomain-like
CDDcd001672.60E-11401444No hitNo description
PfamPF002491.5E-13401442IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 842 aa     Download sequence    Send to blast
MVSIKDTDAE LPALSSKFSG FPHPKSAQIF LDAIKKNRSF QKLVMRNLIH IEAKIEENKK  60
LKERIKILRD FQVSCKRRAG RALSQKKDPR IQLISACKPR KSSVSKVNDK KVPALYLGPV  120
ENSHVDNYRM VMQRFPRSLR RECWSDVERE NLGKGIKQQF QEMLLQKSLE RYSDQMVSSG  180
DSNTFDDIMT SIRDFDIPPE SIRTFLPKVD WERLASLYAV GRSGAECEAR WLNHEDPLIN  240
HNPWTKVEDK NLLFIVRQRG IYNWIDISKR MKTSRTPFQC FVRYQRSLNA HIMKRDWLEE  300
DDAQLRSAVE AFGENNWQLV ASYVEGRTGT QCSNRWMKTL NPARERVGRW TIEEDKHLKV  360
AVVLFGSKTW NKISQFVPGR TQAQCRERWV NVLDPSLNLA RWTADEDFKL KAAIAEHGHC  420
WRKVAEAVPP RTDNQCRRRW KVLFPHEVPI LQAARRVEKI ALISNFVERE AERPELGSSD  480
FLPLPGPNDI TEDGNNIRKG KEKSRRTARS MKQKDMSPGN DDFSKKKKVR KQRLKSSRCP  540
EPPLSSEEIL PSDQILSKEN VGDGDEKTVP KENVAGKKKK GLKPCSKEKC TKSKHCGQEL  600
PLSIETSGGL KNESITEDNT TSKKKRKGRP CSDNKKCKER EPCDHQEPPL SPQLSAILEI  660
IGGEHEILTE DNTTLQNDKR KVRAKRNKYS QQEESNKSKV AGISQSKKSL EIMDEDDELE  720
DNESLASFLH NKMNKVKRKA HISADKNGLV IIPPARKRKV TTEIPSVSET SMLLAETVDG  780
DDEILTSLMK NKVKRRRLKP AGKEKIPKAM NWDDTTLAFF LNKKLKRRSN CSSVDGQAIA  840
L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C9e-292104402155MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-292104402155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1736758KRKAHISADKNGLVIIPPARKRK
2793797KRRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010243797.10.0PREDICTED: uncharacterized protein LOC104587774 isoform X1
TrEMBLA0A059CZT70.0A0A059CZT7_EUCGR; Uncharacterized protein
TrEMBLW9RFI80.0W9RFI8_9R
STRINGPOPTR_0015s04260.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-174myb domain protein 4r1